SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243232.MJ1449 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  243232.MJ1449
Domain Number - Region: 184-274
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0241
Family Restriction endonuclease EcoO109IR 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243232.MJ1449
Sequence length 370
Comment (Methanococcus jannaschii)
Sequence
MPLSKNVIEKISIETIRVLKSRFDTISDEDIKIRNMPFHMAFLRAFYGKIGINDDTEALK
FLTLSQWFHGLSTTLGQSYFENIAHILSNGEKRTFKNYKIKRSVRDKISEIINDLKSGER
LPNVEKENKELREATSKNSEYVNGLEFTADVYFEDKDKVVMIELKTVRPNAGEMRGEKQK
ILYGKAYMMETKPNKKVYYFIGFPYDPTENPENPCGYDKDRFMSSLIEFSKYFDKREVLI
AEELWSFLSGEENTMKKILDIINSIAKPDFKEKFDFINTFPFINQDRLYTKDAIDEQKFK
KYMDILQEWRLYSEIECAKAVKELSLLKLSSRDRRTFERLINNSMFSNNNKYNENRKMKI
LELYNKYMQK
Download sequence
Identical sequences Q58844
gi|15669640|ref|NP_248453.1| WP_010870969.1.84152 243232.MJ1449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]