SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243232.MJ1664 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243232.MJ1664
Domain Number 1 Region: 47-205
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.00000000912
Family MRR-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 243232.MJ1664
Sequence length 226
Comment (Methanococcus jannaschii)
Sequence
MNKLKLKNEKEVRIKFGEYKLTGFSSDNGNNLYKLFNLTLSKIRYRKAMLEHNFQLPKIK
ESHKPKEITEKIKENDIYFLELINEIKKDFKDFCSLDAGTLFELFMYYTLIEFFKENNID
AKVIRNLDVSYKGNIFTEIDLFVDVFGKNFIFECKNRHISSNAILKLYGIMKILNINFGV
LASTKGFYGNLKKEDIFKEYNIYILDKLIEKEKNKIFKELKDIFNI
Download sequence
Identical sequences Q59058
243232.MJ1664 gi|15669860|ref|NP_248674.1| WP_010871188.1.84152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]