SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 243265.plu1148 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  243265.plu1148
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.8e-35
Family SMI1/KNR4-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 243265.plu1148
Sequence length 139
Comment (Photorhabdus luminescens)
Sequence
MNTKLNDVIEEIERLSDGQRNDVDLPDDELISQYEKEIGFEFSNDYKEVLKKISNIFYGT
IDLLSVTRDKKYYGELSQALSDAREQGLPENLLPICEDNGSYYCIDYDGKIKYWTLDGYN
EESWPDLASWIKQVWIEGN
Download sequence
Identical sequences A0A2D0IRN0 Q7M7B0
gi|37524553|ref|NP_927897.1| gi|37525107|ref|NP_928451.1| gi|37525116|ref|NP_928460.1| 243265.plu0547 243265.plu1139 243265.plu1148 WP_011144929.1.100813 WP_011144929.1.49830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]