SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gll1363 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gll1363
Domain Number 1 Region: 182-391
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.85e-26
Family N-acetylmuramoyl-L-alanine amidase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 251221.gll1363
Sequence length 401
Comment (Gloeobacter violaceus)
Sequence
MGSGENDTLLQPEPEDITLAIPTNLSALFKDLVLLYARTEIQYPQLKAVTLAQWILESGW
GESNLAKNHYNFGGLKWRTEMTGFATRILYQANDGPDYYCQFAGLERFIRGYWRFIDRSP
YTGWEERTDSGEEFIRFVGPVYSPSPGYVDRVLALVDEAQILLDNAAEPVIAPIESPSLR
GTVVLDPGHGGTRKIGGSSPNNAISASGIKEKTMTLEIALLIRDALQQIAAQNGYDLRVV
LTRTADVNVGIAERANLASVERADLFLSIHFNGFNKQTSGVETYIRARTNGNVNFEEDEA
FAWRIQGAVLGALRTYLPGTRDRGVKEDTASGGGVLGVLDDRALGNSSQEYPCRACLVEI
EFIDVPRVDRLLNTDAQARQVRGAIAEAIAAAMVEDLQAAR
Download sequence
Identical sequences Q7NKW3
gi|37520932|ref|NP_924309.1| 251221.gll1363 NP_924309.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]