SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gll2004 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gll2004
Domain Number 1 Region: 25-318,467-529
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.98e-65
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 287-465
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000000000628
Family GMC oxidoreductases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 251221.gll2004
Sequence length 535
Comment (Gloeobacter violaceus)
Sequence
MIPTLAAEPRKPARPPLPVRRESREEPVDAVIVGTGAGGAPLLARLAQAGLKVVALEAGN
HWDPAADFATDEREQNKLFWFDERLSAGADPLAFGRNNSGIGVGGSTLHYTAYVPRPQPD
DFRLYSDFGVGEDWPIGYGDLEPYFDELECFLGVSGPSPYPWGPARTPYPLAPMPLNAAA
QLMARGCAALGLRTSPAANAVLSAPYFQSGVGWRSPCTNRGFCQAGCTTGGKAGMDVTFI
PLALAHGAEVRSGAFVTRIETDRAGRVTGVVYVREGREERQRCRTLFLAAGAIETPRLLL
LNGLANQSGEVGRNFMAHPGLQLWGQFSEATRPFKGVPGSLISEDTHRPKDADFAGGYLL
QSIGVMPVTYATQTARGGGLWGEKLQSHMHGYNHTAGINILGECLPYAHNYLELSDEPDQ
RGLPKPRIHFSNGKNERRLRDHAEALMRRIWEAAGAQAVWTFERNAHTIGTCRMGADPKR
AVVDPEGRAFDVPNLYIIDNSVFPSALSVNPALTIMALSLRTADRFIERTQRGEY
Download sequence
Identical sequences Q7NJ28
gi|37521573|ref|NP_924950.1| 251221.gll2004 NP_924950.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]