SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gll2459 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gll2459
Domain Number 1 Region: 116-217
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000589
Family Collagen-binding domain 0.013
Further Details:      
 
Domain Number 2 Region: 227-331
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000183
Family Collagen-binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  251221.gll2459
Domain Number - Region: 95-102
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 251221.gll2459
Sequence length 342
Comment (Gloeobacter violaceus)
Sequence
MARRALPRGGVDKPVVKKRIDEQLWFRAGTGLTATVGLGLLLNWAGPSLVKLPVAGQVFL
QLCRVVNATCEDTGGGLQASSRPDPKPTDRLGVVPPPPPPPPEEHEADLAALQSDSQGNS
LATAIAVDNLDGKQPLRGETNPIDRQDFYRFTLNGPSTVQVLADGTAAAAAILDASGKEI
LTAERGPAGVAIDRSLKAGTYYAWVRGSRRRVGTYNLMLTASAIDSRPGDDTLSTATHVG
ILGEAQNFKDWVGSADEEDFFRFELASESRLNLMLEGRVAHASLLDRNGERLERSDRTDF
GDTLGRTLEAGVYYLHIERDSRKEGAYTLNLSASLEEADAES
Download sequence
Identical sequences Q7NHS6
NP_925405.1.44878 gi|37522028|ref|NP_925405.1| 251221.gll2459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]