SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gll3116 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gll3116
Domain Number 1 Region: 8-388
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.26e-104
Family AAT-like 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 251221.gll3116
Sequence length 392
Comment (Gloeobacter violaceus)
Sequence
MVPPVKHRLSERALAVVPSLIRDASRYCDELGALNLAQGLPDFAAPAFLKEAAQRAIAAD
RNQYCDPWGLAQLREAIAAKCTRDNALAVDPATQVTVCCGATEGINLALMALLDPGDEVV
VFSPFYENYRPNLATVEAKPRYVPLSAPDWRVDEAVLERAFAGTAPRAVIVNNPANPTGK
VWSRQELELVARYCERHDAYAITDEIYEYILYDGAEHISLASLAGMAERTVTVSGLSKTF
CVTGWRLGYVIASEPLTAAIRRLHDFLTICAPAPMQHAAVAALEAPADYYADLRRLYQAK
RDRLVTALYRSGFEPVRPAGAYYVWTDAGVLGAKNALAAAGRLAVEAGIAAVPGDCFLPP
GHPNCNLRFCYAKSDETLAAAVERLDRWSGHG
Download sequence
Identical sequences Q7NGQ2
NP_926062.1.44878 251221.gll3116 gi|37522685|ref|NP_926062.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]