SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gll3816 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gll3816
Domain Number 1 Region: 14-327
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000000000000179
Family Gtf glycosyltransferase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 251221.gll3816
Sequence length 352
Comment (Gloeobacter violaceus)
Sequence
MPLKLCLYSSAHGFGHTTRLLAVASRLRELEAHSRIVLHSHVPDWLVAVHMAKGLERRGT
LLDVGLVQSDSFTTDRDATLERIRALRARSEELVCAEREWLEQEDFDIVLADIPPLAGRL
ADAKRPVWGMSNFGWDFIYRHIEDERFAPLAAWSAQLYRGYSGLFRLPFAEAMDAFAAVE
PVPLVVNEARFGRDHVRHRLGIAPDRPTALMTFGGLGMAAFPAERVAEHPDWQFVVTAAA
PPAPNLTTVEPGAWRLIELLAAVDLAIIKPGYSTVAECCALGLPVACLARPGFAEADLLI
DGMSRLIDCRVLTTEAFLAQRWDFLDGSLACRPPVPAHGAQQVAERLLAVVR
Download sequence
Identical sequences Q7NER2
NP_926762.1.44878 gi|37523385|ref|NP_926762.1| 251221.gll3816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]