SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.glr1861 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.glr1861
Domain Number 1 Region: 33-376
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.39e-108
Family GABA-aminotransferase-like 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 251221.glr1861
Sequence length 382
Comment (Gloeobacter violaceus)
Sequence
MVWYRPRFGGDPRLIPMLDLSLQTARLLPEIEKTLHEICTGGSFILGRHGRALEAEIAAL
SGASFGLGVASGTDALHLVLRALDIGPGDEVITSPFTFIATAEAISYCGATPVFVDIDPE
TFNIDPAQIEARITGRTRAILPVHLFGQAADMDPILEIGRRRGLHVIEDSAQAIGTLYKD
RPVGSLGVAGCLSFYPTKNLGAFGDGGMVVTSDEGLRDRVAALRVHGQTRRYYHDEVGYC
SRLDEMQAAVLRIKLPHLEGWNRRRAQIAQRYNALFSDLPLATPARAAYSTHTYHQYTVR
SVHRERFVAGLGEQKVGVGIYYPVPLHLQNAYAALGYRPGDLPAAEQAAAEVFSLPMFPE
LSDAQIEGVARAMRAAAPVAWV
Download sequence
Identical sequences Q7NJH1
NP_924807.1.44878 251221.glr1861 gi|37521430|ref|NP_924807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]