SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.glr3835 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.glr3835
Domain Number 1 Region: 18-101
Classification Level Classification E-value
Superfamily YggU-like 4.19e-27
Family YggU-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 251221.glr3835
Sequence length 111
Comment (Gloeobacter violaceus)
Sequence
MRSPLPPMPDPEAFPPGAVSVDAGGITLTVWAQPRASCSEVVGWQQNAFKVRLAAPPVEG
KANAECVALIAAFFGVPRRQVSLVQGQQGRHKKIRIEAPADLLLVALQKLS
Download sequence
Identical sequences Q7NEP3
251221.glr3835 NP_926781.1.44878 gi|37523404|ref|NP_926781.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]