SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gvip514 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gvip514
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 1.35e-22
Family Ribosomal protein L28 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 251221.gvip514
Sequence length 81
Comment (Gloeobacter violaceus)
Sequence
MSRKCMLTGKKANNAYSVSFSHRRNKRLQMANLQWKRIWDDQQGCFVRLKLSTKAIKTLE
HRSLHALAKEAGLDLSKYVVK
Download sequence
Identical sequences Q7NEP1
NP_926784.2.44878 251221.gvip514 gi|161702940|ref|NP_926784.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]