SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 251221.gvip567 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  251221.gvip567
Domain Number 1 Region: 6-417
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.66e-181
Family GABA-aminotransferase-like 0.000000000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 251221.gvip567
Sequence length 426
Comment (Gloeobacter violaceus)
Sequence
MPVSDDLLRATDPLVAGWIDRELNRQRSHLELIASENFTSAAVMAAQGSVLTNKYAEGLP
SKRYYGGCEFVDAVEQIAIDRAKALFGAAHANVQPHSGAQANAAVFLALLERGDKILGMD
LSHGGHLTHGSPVNQSGIYFEALHYGVDPASHRIDFDQVRELAHAHRPKLIICGYSAYPR
VIDFECFREIADEVGAYLLADIAHIAGLVVAGVHPNPIPHCDVVTTTTHKTLRGPRGGLI
LTRDEALGKRFDKAVFPGTQGGPLEHVIAAKAVAFGEALQPEFKTYAADVVANARALAER
LTARGLTLVSGGTDNHLMLVDLRSVDLTGKQADLLMSDVNITTNKNTIPFDPQSPFVTSG
LRLGSPAMTTRGLGTTEFGEIGEIIANRLTQPTDARVVADCLERVASLCTRFALYPHLGR
VVAPVG
Download sequence
Identical sequences Q7ND67
251221.gvip567 NP_927315.1.44878 gi|37523938|ref|NP_927315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]