SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 259564.Mbur_0394 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  259564.Mbur_0394
Domain Number 1 Region: 405-490
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000628
Family Anti-sigma factor antagonist SpoIIaa 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 259564.Mbur_0394
Sequence length 512
Comment (Methanococcoides burtonii DSM 6242)
Sequence
MAFIEKLNSDEINFKNEVLSGLTVSLALVPEAVAFSIIANVSPLVGLYSAFIIGLITAIL
GGRPGMISGATGAIAVVVVALVIQHGVEYLFAAVVLMGIIQMIIGALKLGKFIRLVPHAV
MFGFVNGLAIVIFMAQLAQFKVTDINGIEHWLGGQALLVMLGFVGLTMAIIYLLPRFTKA
VPASLAAIIVVSTIVIYFQIQTRTVGDIASIAGGFPKFHLPKVPLNLETIKIIFPYSLIM
ALVGLIESLLTLTVIDEMTETRSRGNKESVAQGVANLVCGFFGGMGGCAMIGQSLININS
GARNRISGIVAALGLLFFVLVGSSLIEKIPMAALVGVMFVVAIGTFEWASLKIFRKVPIT
DVLVMVVVASITVIYHNLAAAVIAGVIISALAFAWEHAKLVRSREIVDDNGIKHYEFFGP
LFFGSVTEFQSKFDVLNDPDEIIIDLKESRVADHSAIEALNKITERYAKVGKTVHLRHLS
EDCRVLLDNASAIIDVNHWEDPHYKVPSDILG
Download sequence
Identical sequences Q12YU0
259564.Mbur_0394 WP_011498548.1.71292 gi|91772444|ref|YP_565136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]