SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 259564.Mbur_2139 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  259564.Mbur_2139
Domain Number 1 Region: 51-228
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.66e-24
Family Terpene synthases 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 259564.Mbur_2139
Sequence length 234
Comment (Methanococcoides burtonii DSM 6242)
Sequence
MEEMIKNTFGWIREQEITTAKGLSRLITAYELWGVENDFPTKLIQLKSENNWDNSIRETA
RACSSLASSNFDLEKCGEWLLSKRENNGSWGNDVYDTTYALIALAEMEIHETKGCKWLVE
NYGEKWEHVGTTSLIITTLAKQEALTKDKHFTDFIEERARWILSERAEEGGWKFISTSNL
VIQALVIVGLKEELKQSLNWLISRQNNNGSWGKNEGDITATALSLITLGYAHRQ
Download sequence
Identical sequences Q12U67
gi|91774067|ref|YP_566759.1| WP_011500147.1.71292 259564.Mbur_2139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]