SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 262724.TTC1499 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  262724.TTC1499
Domain Number - Region: 145-252
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00301
Family Laminin G-like module 0.044
Further Details:      
 
Domain Number - Region: 33-91
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0968
Family beta-sandwich domain of Sec23/24 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 262724.TTC1499
Sequence length 444
Comment (Thermus thermophilus HB27)
Sequence
MRKGLWLLAAGALLGACAPRITAEPLPGVRVDVPVQVPPPASPPQPSQPAGQAQGGVTAP
VIKVLPGNPLPPAGSAYVDDFSSYPTGAVLPVVAPERYGLLRTGGDWQKITVEEAFAPDG
RLDKAVRMEGGYGEGFLTTGAEDWTDYRVSFRLKTLEACCTHSHIRARLFLNGAGSRALE
FFIGRDPINGVGLYKLAGDQRFLLLQRRELNPTANAVLRDGNWHDFVFELRGDGTVRVFV
DRTEVVNWKDPDYHRGGFGIGPVGVTFQLDDLKVERLGGATPPLPGPPTGEAPPRRENFC
GYRAGAELPHERFLADGQVELRLLGGHSAARNYRIGYYPAGKPEAPSYALSYQGNFEPPT
CLNPPLVAIFRPQGSFGLAHNYEHYGNKTVYTEDRFNETPRGFRAYEAINSRGEKEGILL
LVEDWIDGDFDDVGLLLIGAKPEG
Download sequence
Identical sequences Q72HI8
gi|46199801|ref|YP_005468.1| WP_011173874.1.85415 262724.TTC1499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]