SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 264730.PSPPH_3756 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  264730.PSPPH_3756
Domain Number 1 Region: 9-145
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-25
Family Beta-D-xylosidase C-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 264730.PSPPH_3756
Sequence length 152
Comment (Pseudomonas syringae phaseolicola 1448A)
Sequence
MKKLNFSELNWINTPESFSITENELVIHTSPDTDFWRGTYYGLEYNNAPGIVMRSEERFW
TLKSKVAFESYMFFDQCGMLIYIDDNNWMKSGIEYQNNGYQQLFSVVTNNGFSDWAMTNL
DRVTQTMYYRLSRRGNDFLLEHSADVLPLMQN
Download sequence
Identical sequences A0A0P9ZCY4 Q48FD9
gi|71734187|ref|YP_275898.1| 264730.PSPPH_3756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]