SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266264.Rmet_0268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266264.Rmet_0268
Domain Number 1 Region: 75-220
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000252
Family Glutathione peroxidase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266264.Rmet_0268
Sequence length 225
Comment (Ralstonia metallidurans CH34)
Sequence
METYKRTMNAQTNAMPQPDPTASPDPRIDARTRRGRLQMLMLLLVCASPVLFSYFTYYVI
KPTGGSTNYGVLIDPQRPMPPVQVTNERNESVPLASMRGKWLMVMTDPSACDETCAKKLF
TVRQIRVGQGEDRERIVPVWLIQDRGDVDDRLAAAYNEPYAGVRFLRMDRATIAQWLPAE
DGARVEDAIYLVDPLGNLMMRWPKDPDPKKISSDLKKLLKYSRIG
Download sequence
Identical sequences Q1LRS2
266264.Rmet_0268 gi|94309213|ref|YP_582423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]