SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266264.Rmet_0271 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266264.Rmet_0271
Domain Number 1 Region: 45-203
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.05e-50
Family Glutathione peroxidase-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266264.Rmet_0271
Sequence length 204
Comment (Ralstonia metallidurans CH34)
Sequence
MSTSSQGLWAAFRRFWLLALCTALLAACGQPKPSFRNVDISGATEFGKDFALLDPTGKTR
TLADFKGKVVLMFFGYTHCPDVCPTTMVELKQVMEQMGPDADKVQVLFVTVDPDRDTAAL
MAQYVPAFDSRFLGLRPADEAALKKVTKDFKVYYAKVPGSSPDNYTMDHSAGSYVFDQNG
QLRLFIRHGQGPEPIAHDLKQLMS
Download sequence
Identical sequences Q1LRR9
WP_011515161.1.12480 WP_011515161.1.25839 WP_011515161.1.52493 gi|94309216|ref|YP_582426.1| 266264.Rmet_0271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]