SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266264.Rmet_0553 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266264.Rmet_0553
Domain Number 1 Region: 16-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.69e-49
Family NQO2-like 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266264.Rmet_0553
Sequence length 169
Comment (Ralstonia metallidurans CH34)
Sequence
MPDTIPTGGDAAGVADAVARIVAARRDMPGALLPILHDIQDSQGFIPADAVSVVARALNL
SRAEVHGVITFYHHFRERPAGRTVVQVCRAEACQSVGADALAAHARKALGCDFHETTADG
QFTLEPVYCLGQCACGPAMTIGDRLHGRVDMQRFDKLIDAVREREEAQA
Download sequence
Identical sequences Q1LQY7
WP_011515415.1.12480 WP_011515415.1.25839 WP_011515415.1.52493 266264.Rmet_0553 gi|94309498|ref|YP_582708.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]