SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266264.Rmet_1917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266264.Rmet_1917
Domain Number 1 Region: 3-211
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.64e-40
Family DsbA-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266264.Rmet_1917
Sequence length 217
Comment (Ralstonia metallidurans CH34)
Sequence
MTPIDIIITYDFICPWCWIGHQSLKAGIEQAGMAGRFRSQYQPYELNPDMPKPSSNRKAY
RSRKFGSWERSQVLDAEVAAAGKRVGLAFNYDRILVTPNTRLAHRLMRYVLDQDAARADD
LFSAVMEAYFTRGQDIGSLDVLVDIAVSIGFDAAGVREYLNGSAGETSVVAQELQAQFDG
VRSVPTYRVGNQRITDGQPPQHFARVLQAAAGEVENM
Download sequence
Identical sequences Q1LM30
WP_011516649.1.12480 WP_011516649.1.25839 266264.Rmet_1917 gi|94310855|ref|YP_584065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]