SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266940.Krad_2127 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266940.Krad_2127
Domain Number 1 Region: 25-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.07e-20
Family GntR-like transcriptional regulators 0.021
Further Details:      
 
Domain Number 2 Region: 100-229
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.4e-16
Family GntR ligand-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266940.Krad_2127
Sequence length 257
Comment (Kineococcus radiotolerans SRS30216)
Sequence
MSARSWPTPRRCCDTSHYSAAMAAVRDSRTTRARVYETLRRQVVTLELPPGAALSENELS
ATLGVSRTPVREALILLAEEGLVQVFPQVGSFVSRVDPRRVADAQFIREAVELAALADLP
AHLDPDLVRELQDNVERQRRPGLDARAFFDLDELFHASLLQLSGHGNAWPVVQRAKAHLD
RARQLGLDEAHVQESRVSEHEEVLRAVLDGRQEEAVDLLRTHLRAVLADVDRVREESPHL
FHDGTLAPTRRSIAVWT
Download sequence
Identical sequences A6W9X2
WP_011981250.1.7041 gi|152966091|ref|YP_001361875.1| 266940.Krad_2127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]