SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266940.Krad_4399 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266940.Krad_4399
Domain Number 1 Region: 97-225
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.62e-27
Family GntR ligand-binding domain-like 0.0085
Further Details:      
 
Domain Number 2 Region: 13-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.82e-20
Family GntR-like transcriptional regulators 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266940.Krad_4399
Sequence length 250
Comment (Kineococcus radiotolerans SRS30216)
Sequence
MPPAPVSPHRGLLTERIARELEHEIRTGALAVGDKLPSERELSARFAASRGVVREVLRRL
EAQHLIEVAAGRGSFVSSPGLAESRGFDAVYRASRPTVRQLIRARLPLEVESAGLAAELA
TEEDLATLAAAHRAVLEAPDAVAMARADLGFHEAIAVTSGNPVLRIMLLSIGPMMFEMML
RSNSDPSIAEPGVPHHAEILAAITAHDVELARENMREHLALGLRTYGPDLDEPLEVMANR
HLEHLLQHPF
Download sequence
Identical sequences A6WGB9
266940.Krad_4399 gi|152968338|ref|YP_001364122.1| WP_012085840.1.7041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]