SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269796.Rru_A3785 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269796.Rru_A3785
Domain Number 1 Region: 295-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.96e-49
Family Ribonuclease PH domain 1-like 0.0000184
Further Details:      
 
Domain Number 2 Region: 4-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.57e-48
Family Ribonuclease PH domain 1-like 0.0000215
Further Details:      
 
Domain Number 3 Region: 146-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.54e-28
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 450-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.95e-26
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 5 Region: 554-640
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.01e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 6 Region: 620-694
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.12e-21
Family Cold shock DNA-binding domain-like 0.0005
Further Details:      
 
Domain Number 7 Region: 242-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000199
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269796.Rru_A3785
Sequence length 708
Comment (Rhodospirillum rubrum ATCC 11170)
Sequence
MSLFNVFRKEIEWGGRKLVLETGRIARQADGAVMASLGDTTVLCTAVGAKTKSKFDFFPL
TVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFVHGYKNETQLVCTVLC
HDLENNPDIVAIVGASAALTLSGLPFLGPIGAARVGLIDGAFVLNPTRDQMADSVLDLVV
AGTREGVLMVESEAHELSEQQMLDAVMFGHEGYQPVIDAIIALAEQCAREPRAIEPPAPE
AEAVAAKVREVGEAGLRDAYKEADKMVRHDKVDAVRDAVTAAFAGDDAALALAGAAFKDL
EKDIVRGSILDTGLRIDGRDTKTVRPIEIYPGILPRAHGSALFTRGETQALVTTTLGTGQ
DEQIIDALEGEYRENFMLHYNFPPYSVGEAGRMGSPGRREIGHGKLAWRAIHPMMPAKDA
FPYTVRVVSEITESNGSSSMATVCGTSLALMDAGVPLKNAVAGIAMGLIKEDERFAVLSD
ILGDEDHLGDMDFKVAGTANGITSLQMDIKITSITKEIMNVALNQAKDGRIHILGEMTKA
LGNARSDVSDFAPRITTIKVPPQKVREVIGSGGKVIREITEVTGTKIDIEDDGTIKIASA
DAEATQRAVDWIKGIVAEPEIGVVYTGKVVKIMDFGAFVNFLGTRDGLVHISELSQDRVK
KVGDVVNVGDQVKVKCVGFDDRGKIKLSMKQVDQVTGADLSTQAPAEE
Download sequence
Identical sequences Q2RMR6
gi|83595114|ref|YP_428866.1| 269796.Rru_A3785 gi|386351881|ref|YP_006050129.1| WP_011391532.1.3410 YP_428866.1.57063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]