SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269797.Mbar_A1577 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269797.Mbar_A1577
Domain Number 1 Region: 279-351
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000196
Family Collagen-binding domain 0.007
Further Details:      
 
Weak hits

Sequence:  269797.Mbar_A1577
Domain Number - Region: 595-653
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00759
Family Collagen-binding domain 0.015
Further Details:      
 
Domain Number - Region: 416-483
Classification Level Classification E-value
Superfamily Aldehyde ferredoxin oxidoreductase, N-terminal domain 0.0602
Family Aldehyde ferredoxin oxidoreductase, N-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269797.Mbar_A1577
Sequence length 744
Comment (Methanosarcina barkeri fusaro)
Sequence
MRPYIQRILIYLLASLTVCLLIVPPGFAAPAPAISGLPFDTNETLSDGFCWNATTFGGFF
YPVNKHKSFVTSENWWGERLQYVEKDGQNELGKGHPGNHVIGEGELVYTTRPLSSKYGVV
SDLELDAGTTPNELGGMFYYQLPWFGKPYVAVGNDTTRLAKLVISQPSSGKKTLKAGDSW
DLGSNYSLVVNQVDVDGEKVWFSLDKNGEEIESGIVNTSGNVADKTFTATADFGDKKDQL
YFVTYVDKVFTSATDSFAVFKYTWLIDKDNMMIIENGDEYQDFEVKEASENEIVLTNSNS
ITLNLDKDNKNYFTDSWYFQTSDEGKGSTSPEGYVIYLAKELNIPGNYTLRGLPFDTNET
SSDGFYWNATTFGGFSYPVNKHKSFVASENWWGERLQYVEKDGQNELGKGHPGNHVIGEG
ELVYTTRPLSSKYGVVSDLELDASTTPNELGGMFYYQLPWFGKSYVAVGNDSTRLAKLVI
SQPSSDKKTLKAGDSWDLGSNYSLVVNQVDVDGEKVWFSLDKNGEEIESGIVNTSGNVAD
KTFTATADFGDKKDQLYFVTYVDKVFTSATDSFAVFKYTWLIDKDNVMVIENGDEYQGFE
VKTASENEIVLANSNSITLNLDKDKKNYFTDSWYFQTSDEGKGSTSSEGYVIYPATDVTV
EDTAISGVNNSENLSNESLSNESASSTSSAPLLESKANDLKDINNSNLPEEKTGIETSTK
ASGFEVLAGVFGIILCQYFVKRRD
Download sequence
Identical sequences Q46C68
269797.Mbar_A1577 gi|73669089|ref|YP_305104.1| WP_011306570.1.36239 WP_011306570.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]