SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269797.Mbar_A2453 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  269797.Mbar_A2453
Domain Number - Region: 3-33
Classification Level Classification E-value
Superfamily RING/U-box 0.00307
Family RING finger domain, C3HC4 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269797.Mbar_A2453
Sequence length 73
Comment (Methanosarcina barkeri fusaro)
Sequence
MLKCYDCAEENKESEAVGVCIVCGKGLCIDHIKEVELPMKGGYPLPHLTLKKDLPRMMCR
ECIDATIGDIGCV
Download sequence
Identical sequences A0A0E3QN87 Q469S3
269797.Mbar_A2453 gi|73669934|ref|YP_305949.1| WP_011307414.1.36239 WP_011307414.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]