SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269797.Mbar_A2519 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269797.Mbar_A2519
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.24e-33
Family Sfri0576-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269797.Mbar_A2519
Sequence length 120
Comment (Methanosarcina barkeri fusaro)
Sequence
MIKIMQGLPGNVVAVNVSGEVTGDDYKNVLIPAVEEKIQKYGKVRILYYMDKDLEWFTLN
AMLEDAKVGILNITDFEKIAVVSDVDWMNVAVEIFKFIVPFPVRTYKNEELSEAEAWISE
Download sequence
Identical sequences A0A0E3QMC6 Q469L0
WP_011307475.1.36239 WP_011307475.1.74748 269797.Mbar_A2519 gi|73669997|ref|YP_306012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]