SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269800.Tfu_0926 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269800.Tfu_0926
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily Cgl1923-like 1.83e-86
Family Cgl1923-like 0.00000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269800.Tfu_0926
Sequence length 313
Comment (Thermobifida fusca YX)
Sequence
MRDPADLYELRSDLPELSEPVMLVSLDGFVDAGAAGKQAVATLLDGLQHTELATFDIDGL
LDYRSRRPVMIFNETTWVSYAEPKLSLTLLHDLEGTPFLLLHGLEPDRRWEGFTAAVRQL
VERLSVRLTVCFYGIPMAVPHTRPVTATPHATRPELVTEHTPWVGRIQVPGNIMSLLEYR
LGQAGHDVIGYAVHVPSYLAQSEYPRAGLAVLEYIARVTGLVLPTEKLAEEATRVDGEIN
RQVEASEEVQRVVRNLEAQYDNFMAVHNGLDVDALLAGDESRLPTADELGAELERFLAEH
GRGSAEHDRGSEG
Download sequence
Identical sequences Q47RF3
WP_011291373.1.46431 WP_011291373.1.72373 WP_011291373.1.82272 269800.Tfu_0926 gi|72161330|ref|YP_288987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]