SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272557.APE_2450.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272557.APE_2450.1
Domain Number 1 Region: 161-487
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.79e-97
Family Leucine aminopeptidase, C-terminal domain 0.000000838
Further Details:      
 
Domain Number 2 Region: 24-155
Classification Level Classification E-value
Superfamily Macro domain-like 0.000000000000706
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272557.APE_2450.1
Sequence length 492
Comment (Aeropyrum pernix)
Sequence
MVLYTRPPRLSVSRETFFGRQTPVVIPVFKEGDSIKLPEGLPQDLESLLKESYNSKAVSP
EPGSVAKLPYRGGLVVTAGCGAPGDLEGVRRGFAAASRQVVDSFEEAQLYLVGLDTVSST
EAVIGALLGAYRLEEFKNTRKRKLQQLWVYGGEPRLDYAQAVAEGVYLARDIANAPPHRL
PPAKLAAAVEDLFSKFDNVDVEVFSYDRLLEEGFGGIVSVGMGSEEKPRLIIIKYRGGAG
EPIALVGKAVVFDSGGINLKPSQGMTLMRADKAGGAAVVGAMWTAARLGIKASIIGLIPA
VINVPSGSSYLPSDVIRMWDGTMVEITNTDAEGRLILADAISYAAKQLGAKTVIDLATLT
GAIVVALGPLIAGLFTRSDGLARAFEEASRTTGEKIWRMPMEDEYAKSLTQPAQAGEIVN
AAQRYGGAIFGALFLERFVHGKEFAHLDIAGPGIAFEAGSLAPPYWPEKGMAPGYGVRLL
IEVLSRMARGGG
Download sequence
Identical sequences Q9Y935
272557.APE_2450.1 gi|118431875|ref|NP_148619.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]