SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272559.BF3701 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272559.BF3701
Domain Number - Region: 53-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0018
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272559.BF3701
Sequence length 115
Comment (Bacteroides fragilis NCTC 9434)
Sequence
MKQKKRPASQTEAMKLRWKKRIVFEKGYTEMCAEWMAERLEALTDHLQYGHAAIAYQKQN
GDFRLVKATLIYYEAEFHKKYDPTQIEGAVVYWNVDEQRWTTFQMENFMEWRPIV
Download sequence
Identical sequences A0A015SL00 A0A0E2A7M7 I9AYE2 Q5L950
WP_005791082.1.37988 WP_005791082.1.44936 WP_005791082.1.49420 WP_005791082.1.58084 WP_005791082.1.63108 WP_005791082.1.76253 WP_005791082.1.85293 WP_005791082.1.89499 WP_005791082.1.93484 WP_005791082.1.9461 gi|60683147|ref|YP_213291.1| 272559.BF3701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]