SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272562.CA_C1304 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272562.CA_C1304
Domain Number - Region: 91-175
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0607
Family BAR domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272562.CA_C1304
Sequence length 252
Comment (Clostridium acetobutylicum)
Sequence
MNNNVELAYLIQENYDLIKESKKILRDGSYIYLLKKLKSEFETAKKNYVNRKTELAKIKQ
SYSAISIELRKEREKMETNEYKLYNKAGSNLNMIEKLEGAIEIEKQNLKNLEDEAVDLLD
EEEKLKKEIEDLRLKLVNIKDNFYDYKEKSSEKVEKARQEMIAAKTKIEEIKSKIPKELF
EEISHLMSKSSCAVAKLNGEICGGCRMKVSSMTIDDLINNNSIVHCDNCGRILYYDESEG
KIKRKYKRKIRA
Download sequence
Identical sequences Q97JH9
gi|337736522|ref|YP_004635969.1| gi|384458029|ref|YP_005670449.1| 272562.CA_C1304 NP_347935.1.94244 WP_010964616.1.17575 WP_010964616.1.17905 WP_010964616.1.48544 WP_010964616.1.57811 WP_010964616.1.71350 WP_010964616.1.92914 gi|15894586|ref|NP_347935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]