SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272623.L39650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  272623.L39650
Domain Number - Region: 13-85
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000581
Family Legume lectins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272623.L39650
Sequence length 926
Comment (Lactococcus lactis)
Sequence
MNGQAKTISASAKGIPQPSNNNFVDFTMSYNGTTKVMSITYGGQTWTQNVSSFIGTNQAM
SFSIAASTGAQMNLQQLRNVNFTYTVAQGTVIANYVDEQGNTIAQQETTSGDIDTPYVTS
QKTIPGYTFKASNGAATSGNYAANDQTVNYVYTRNQGSIDVTYIDQTTGQTLSKKDLSGG
TGDSSNYTTTDTIKSYTDAGYELVSDNYPSGGTVFTDTAQHYVVNLKQKLVVSSEQKQVN
ETIQYVYEDGSKAADDYNAPPLNFTRSVTTNQVTGEKTYGDWQAQNGDSFGEVVSPTIKG
ETADQLKIDAISGITANSADIQKKVVYKRNQGTIDVTYIDETTGQVLTKKDLSGGTDDPS
NYTTADDIKSYTDKGYELVSDDYPSGGTVFTDEPQHYVVKLKHGLTESTDKKAVNQVIHY
VYEGGGEAATDHNATVDFSRTITTDRVTNDKTYGDWTADNGDSFASVTSPVIDGYTADQL
KVSEMTGITADTEDISVTVTYTRNQGTIDITYIDQTTGQTLSKKDLSGGTGDDSGYTTAD
TIKSYTDKGYELISDDYPEDGTKFADDPQHYIVRLKHGLTEVTENKTVNQVIHYVYEGGG
EAATDHNATVVFSQTITTDKVTGEKTYSDWTADNGDSFASVTSPVIDGYTADQLKVSEMT
GITVDTEDISVTVTYTRNQGTIDVTYIDETTGKILTTKDLSGGTGDDSGYTTADTIKSYT
DKGYELVSNDYPEDGTKFADDPQHYIVRLKHGTVVETENKSVNEVIHYVYDNGDKAADNY
KATIVFSRTITTDKVTGEKTYSDWTADNGGRFAAVLSPIIKDYIASQLKVDEMTGITVDT
ADIERIVVYHKVPAGIIVPPVHPDKPSQPSNNQSKIPTAKAVKDSKPTDVLPSTGDSQKS
QIVLTLLGIMAVIISPLALLLRRRKQ
Download sequence
Identical sequences Q9CDN9
272623.L39650 KR68 NP_268337.1.16647 WP_010906364.1.39480 WP_010906364.1.39902 WP_010906364.1.55618 WP_010906364.1.56612 WP_010906364.1.70979 WP_010906364.1.7442 WP_010906364.1.91600 gi|15674162|ref|NP_268337.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]