SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272626.lin2918 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272626.lin2918
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.76e-41
Family SMI1/KNR4-like 0.0000000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272626.lin2918
Sequence length 159
Comment (Listeria innocua)
Sequence
MASSFLEEVDRLITLSGITFHASGTGTPELIKIYQDALGNEFPETYKLFLEKYGTLTFNG
VSFYGISKRGLSAASIPDVKFATEQARTFGDINKEMIMIKNSGYGSIFSIDTSIIGSEGE
PVIVETNLSFKDNTEKKVVANSFGEFLLEEIELSLTDLG
Download sequence
Identical sequences Q926X2
gi|16801977|ref|NP_472245.1| 272626.lin2918 368054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]