SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272994.SPAB_02408 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272994.SPAB_02408
Domain Number 1 Region: 45-158,193-367
Classification Level Classification E-value
Superfamily Kelch motif 6.41e-29
Family Kelch motif 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272994.SPAB_02408
Sequence length 382
Comment (Salmonella enterica serovar Paratyphi B SPB7)
Sequence
MKNFKKMMTLMALCLSVAITTSGYATTLPDIPEPLKNGTGAIDNNGVIYVGLGTAGTSWY
KIDLKKQHKDWERIKSFPGGAREQSVSVFLNDELYVFGGVGKKNSESPLQVYSDVYKYSP
VKNTWQKVDTISPVGLTGHTGVKLNETMVLITGGVNEHIFDKYFIDIAAAAADESEKNKV
IYNYFNKPAKDYFFNKIVFIYNAKENTWKNAGELPDAGTAGSSSVMENNFLMLINGELKP
GLRTDVIYRAMWDNDKLTWLKNSQLPPSPGEQQQEGLAGAFSGYSHGVLLVGGGANFPGA
KQNYTNGKFYSHEGINKKWRDEVYGLVNGHWQYMGKMKQPLGYGVSVSYGDEVFLIGGEN
AKGKPVSSVTSFTMRDGNLLIK
Download sequence
Identical sequences A0A2I6TM92
272994.SPAB_02408 gi|161614657|ref|YP_001588622.1| gi|409249519|ref|YP_006885344.1| ABFF01000014|CDS_59015-57867 CP000886|CDS_1988577-1987429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]