SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273057.SSO0736 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273057.SSO0736
Domain Number 1 Region: 67-157
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.18e-20
Family Cold shock DNA-binding domain-like 0.0000148
Further Details:      
 
Domain Number 2 Region: 153-234
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000002
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000135
Further Details:      
 
Domain Number 3 Region: 8-65
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000000322
Family ECR1 N-terminal domain-like 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273057.SSO0736
Sequence length 249
Comment (Sulfolobus solfataricus)
Sequence
MNMSQSQKIVLQPRSIVVPGELLAEGEFQIPWSPYILKINSKYYSTVVGLFDVKDTQFEV
IPLEGSFYYPKINDIVIGLVEDVEIYGWVVDIKAPYKAYLPASNLLGRSINVGEDLRRYL
DVGDYVIARIENFDRSIDPVLSVKGKDLGRVSNGIVIDIMPVKVPRVIGKNKSMYETLTS
KSGCSIFVANNGRIWATCPSRFSEEILIEAIRKIENESHIKGLTDRIKQFIEEKLGERNA
SSGETKTNS
Download sequence
Identical sequences A0A157SZ15 Q9UXC4
gi|15897637|ref|NP_342242.1| 3l7z_C 3l7z_F 3l7z_I 273057.SSO0736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]