SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273063.ST0004 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  273063.ST0004
Domain Number - Region: 5-31
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00101
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273063.ST0004
Sequence length 102
Comment (Sulfolobus tokodaii)
Sequence
MRIMEYKCFICKNIFDSFRNLKIHVIRAHNNGQCPLCGKETKNLSMHSKMMAKSDPWHLV
LSCILTECDYINDDEIKRMMINLVKIVLVESVPLDIISKEEN
Download sequence
Identical sequences 273063.ST0004 WP_010977934.1.60790 gi|15920174|ref|NP_375843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]