SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273063.ST0440 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273063.ST0440
Domain Number 1 Region: 7-112
Classification Level Classification E-value
Superfamily Prefoldin 2.88e-23
Family Prefoldin 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273063.ST0440
Sequence length 125
Comment (Sulfolobus tokodaii)
Sequence
MTERIPPELQTQLVKLQQLQDQLNRLLTEKNVIDSELREVNKILQELSQLPAGTTVYKIV
GNLLVKTDKETVQKELDDRKEILELRSRTYQKQENLLRTQLEDLQKKVNELLAKYYPQSG
GAIKA
Download sequence
Identical sequences Q975H2
gi|15920651|ref|NP_376320.1| WP_010978412.1.60790 273063.ST0440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]