SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273063.ST0530 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273063.ST0530
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000175
Family GHMP Kinase, N-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273063.ST0530
Sequence length 249
Comment (Sulfolobus tokodaii)
Sequence
MTDIEIIVPLNISGIWYPVYTEDIRYTGSIGLSLVLNPPIIAFPKKGEPEIYFNNQRVNF
PNLKYLSLLANVKLYIQSEVPLGFGYGLSGAISLAYALASYELYNIKLEDALVVAHESEI
FTNNGLGDLISEYYGGGLVYRKKPGAPGYGEVEKIIVEWEPICSKPLSKESTEKLIKNKN
DNALVYINQFLHNPSLLKFFDLSRKFTEEIGFISPFPNSFRKKGLILRLKECEEGWIKHT
PAIHGAYIR
Download sequence
Identical sequences Q974Y2
WP_010978508.1.60790 273063.ST0530 gi|15920747|ref|NP_376416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]