SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273063.ST0903 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273063.ST0903
Domain Number 1 Region: 494-562
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000000147
Family Transglutaminase, two C-terminal domains 0.0057
Further Details:      
 
Weak hits

Sequence:  273063.ST0903
Domain Number - Region: 605-671
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00497
Family Transglutaminase, two C-terminal domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273063.ST0903
Sequence length 869
Comment (Sulfolobus tokodaii)
Sequence
MKRLSLLLVLFLLISPLLSLALPTTSTNFSATAQWEVTPPYNVAPGETLVPAQVTLTYNG
EFTLYNVIIKPYNFPAISPFTSNTTYEISKIEPGQQLSLVFLVNISPSIPLGVYNFYISI
YNSSIVFPDCVVSAQLPVLGYVNLYATAQASGILFPGERDVPIDITIYDTGSVSATDVTL
FLNSSYPIQFVTKEVKVPEISTTTPATVQVLANVYSNATVGTYQLKLTALVFGTLYKSLN
VSVSINSNQTVEGKLLNPSVIDDIGSYQDNVPINLQLEYTGPVEINSYSIIITLPQGFTN
ESGGNEIIINGGSVQPNEIIPLTFSLNTKNINLTSYTFPIKIIWNAVEGEGEIVSVVQYI
SFTLIAMGNNEIQITPLTSILYSNSINNVTILLTNQGSGNIYNVTLSVSSPQASILSYKS
QIPEIKAGQSVSIPIELFIPEALQGNSLSITISLNYLNSMYEESQYSQELGFYVASKNYV
PILISLNPPILSPGEFQSTQLILQNTLNTTLYNVSISLSSQGIYLNNTVFEIHTISPHGN
YTVPIELFSSSPGTYTLTVSVSYFDSLVQNSEELNIPIYFSQLNAPSVPILLTLNYTVLT
YDILQNAKLLITNTLNEPIYNVTISLSSQGEIYVNNTIITLPELKPLETLSIPIKVYVGT
TGIVSISASMSYYISGQQKESEELINSLAAGSVDLVVTSVTTLNVGTIISVTGTIYNFGT
GSANGLTVIAEPTRGLQVVGQNTYYVGNLGPDTSSTFTFAFRILNVTAFNRTAFNGFSDP
SSFTRSFANFTGRVFLVPIEFVYTNDIGQVIHTYSNITIHVTNSSEAFTTLTFHSTTTHG
RFFTLIGILILVVIVIVVVVLVLRRRRKE
Download sequence
Identical sequences Q973J5
WP_010978900.1.60790 273063.ST0903 gi|15921139|ref|NP_376808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]