SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281090.Lxx10170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281090.Lxx10170
Domain Number 1 Region: 6-267
Classification Level Classification E-value
Superfamily Cgl1923-like 3.92e-74
Family Cgl1923-like 0.00000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281090.Lxx10170
Sequence length 309
Comment (Leifsonia xyli xyli CTCB0)
Sequence
MRDPGELFELTSALEVPDGLPLVAGLTGFADAGSGVSQLGTYLLATLHSEVVATFDADIL
LDYRARRPIIYFDQDHLDGYQPSTLKLYLVYDELRQPFLLLSGFEPDFRWEAFTEAVLGL
MERFRVKSVTWVHAIPMPVPHTRPIGVTVSGNRAELIEAMSIWKPQTQVPANALHLLEFR
LQPLSYPIAGFVLLIPHYLADAEYPAAAITGLESISAATGLIFPTDRLREDDRQFVANIN
EQVAGNAELGRLVGTLENRHDSYMEDNQPRSPLTDRDGELPSADEIAAELENFLAFRRHG
DEDNSRGDR
Download sequence
Identical sequences A0A1E2SKX5 Q6AFG1
WP_011185880.1.68452 WP_011185880.1.84704 281090.Lxx10170 gi|50954701|ref|YP_061989.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]