SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281309.BT9727_0466 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281309.BT9727_0466
Domain Number 1 Region: 855-964
Classification Level Classification E-value
Superfamily Collagen-binding domain 9.81e-30
Family Collagen-binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 762-850
Classification Level Classification E-value
Superfamily PKD domain 2.75e-18
Family PKD domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281309.BT9727_0466
Sequence length 965
Comment (Bacillus thuringiensis konkukian)
Sequence
MNKKSKINKVMLSISTMALSLGALQAPVSAEEKVPYNVLKTKPVGIEKPVDEIGHISKAE
ETLSFQERLKVGDFSQRPASITNKATVKQVKESYSMADLNKMNDQELVETLGSIKWHQIT
DLFQFNEDAKAFYKDKRKMQVVIDELAHRGSTFTKDDSKGIQTFTEVLRSAFYLAFYNNE
LSELNERSFQDKCLPALKAIAKNPNFKLGTAEQDTVVSAYGKLISNASSDVETVQYASNI
LKQYNDNFTTYVNDRMKGQAIYDIMQGIDYDIQSYLIEARKEANETMWYGKVDGFINEIN
RIALLNEVTQENKWLVNNGIYFASRLGKFHSNPNKGLEVVTQAMHMYPRLSEPYFVAVEQ
ITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGSIVFKTGDKVSEEKIKRLYWAA
KEVKAQYHRVIGNDKALEPGNADDILTIVIYNSPEEYQLNRQLYGYETNNGGIYIEETGT
FFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLFGRGDMYQNERLTWFQEGNAEFFA
GSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKYGSWDFYNYSFALQSYLYTHQFETF
DKIQDLIRANDVKNYDAYRENLSKDLKLNEEYQEYMQQLIDNQDKYNVPEVADDYLAEHA
PKSLTAVEKEITETLPMKDAKMTKHSSQFFNTFTLEGTYTGSVTKGESEDWNAMSKKVNE
ALEQLAQKEWSGYKTVTAYFVNYRINSSNQFEYDVVFHGIAKDDGENKAPTVNINGPYNG
LVKEGIQFKSDGSKDEDGKIVSYLWDFGDGSTSAEVNPVHVYEREGSYKVALIVKDDKGK
ESKSETTVTVKDGSLTELEPNNRPEEANRIGLNNTIKGSLIGGDHTDVYTFNVATTKNID
ISVLNEYGIGMTWVLHHESDMQNYAAYGQANGNHIEANFNAKPGKYYLYVYKYDNGDGTY
ELSVK
Download sequence
Identical sequences Q6HNQ7
281309.BT9727_0466 WP_001036395.1.43104 YP_034814.1.62562 gi|49476834|ref|YP_034814.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]