SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281309.BT9727_3286 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281309.BT9727_3286
Domain Number 1 Region: 863-970
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.67e-28
Family Collagen-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 771-856
Classification Level Classification E-value
Superfamily PKD domain 4.05e-23
Family PKD domain 0.00074
Further Details:      
 
Weak hits

Sequence:  281309.BT9727_3286
Domain Number - Region: 187-295
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0401
Family 14-3-3 protein 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281309.BT9727_3286
Sequence length 971
Comment (Bacillus thuringiensis konkukian)
Sequence
MKGYSKKVLVGVSFASLMLGGFQGGALAEGTKGEQASYRNVLKMEPVGVQLPVQELAHSS
KVLENKSFEKRLQFADLSQRPPELKKESKQLATAKTYTIAELNQLSNQQLVDLLVTIDWE
QITGLFQFNKDSLAFYQNDSRMQAIIDKLNQQGQAYTKDDSKGIETLVEVLRSGFYLGFY
HTELSKLNERSYHDKCLPALKTIANNPNFKLGTLEQNRVVSSYGKLIGNASSDVETITSA
AKIFKQYNDNFSTLVDNLSAGNAIYDIMQGVDYDIQSYLYDTRKAPKDTVWYQKIDSYIN
ELSRFALIGTVTEKNGWLINNGIYYTGRLGTFHSTGTKGLQVVTDAMKMYPYLGEQYFVA
AEQIATNYGGKDANGNVVNLDQIREDGKKKYLPKTYTFDDGTIVLKAGDKVTEEKVKRLY
WAAKEVKAQFHRTVESDQPLEKGNADDVLTMVIYNSPAEYQFNRQLYGYETNNGGLYIEG
TGTFFTYERTPEESIYSLEELFRHEFTHYLQGRYEVPGLWGQGKIYENERLSWFEEGNAE
FFAGATRTDNVVPRKSIIGGISSNPAERYTAERTLNAKYGTWDFYNYSFALQSYMYNKRY
DMFDKVHDLIRKNDVTAYDAYRSALSKDANLNKEYQDYMQMLVDNRDKYNVPLVSDDYLA
THAPKPVSDIVAEITAEAKLSNVSVKKNKSQFFHTFTLQGTYTGTTAKGEYEDWKSITQN
VNDTLKRLSAKEWTGYKTVTAYFVNYRVNASGQFEYDVVFHGINTEEGAVNKAPVAVING
PYSGNVNEAISFKSDGSKDEDGKIVAYKWEFGDGTVSNEQNPTHVYTKEGTYTARLTVTD
DKGLTNTVTTNVTVQKKEDNSVEKEPNNSFQTANTLQFNQVLRASLGNGDTSDFFEINVE
TAKNLQINVTKENNIGVNWVLYSEADLNNYITYAQQEGNKLVGSYYTYPGKYYLHVYQYG
GGFGNYTVEVK
Download sequence
Identical sequences Q6HFR8
gi|49478266|ref|YP_037608.1| 281309.BT9727_3286 WP_000679549.1.43104 YP_037608.1.62562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]