SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281309.BT9727_3502 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281309.BT9727_3502
Domain Number 1 Region: 180-463
Classification Level Classification E-value
Superfamily Subtilisin-like 3.53e-36
Family Subtilases 0.00043
Further Details:      
 
Domain Number 2 Region: 503-612
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.83e-32
Family Collagen-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281309.BT9727_3502
Sequence length 613
Comment (Bacillus thuringiensis konkukian)
Sequence
MKIFQKMCASTVIITTLLGIGGTVNSVHADSIEQQSKLGIDQETDKQIIVKFKADLKFPY
EDGIEKQIQSQTNDKVLEDLLVEYPDVTFTRLFTSVSPEEIEDLEVKAPNNVSTSLLNYY
ILQTQNGEQKEELVDRLKKSCLIEDVYMKKQEKITPPEVQPSSVSLSPNNNPRFKQQGYL
EAAPYGINAPFAWEVQGGKGSGITFVDMEYGWLLNHEDLVHQNIELMSGINIDQHVGHGT
SVLGIVSSEDNEVGNIGIAPKAKAKVISQIRDNGQYNTADAILSAVNQLEAGDVLLLEAQ
ASFDGYGDKYLPVEVQPDIFDAIRAGTDKGVVIIEAGANGWNDLDQFKDRNGKQILNRNS
KDFKDSGAIMVGAGSSSFPHERMWFSNYGSRIDVYGWGENVDTTTAEQSRSAVNLYTSSF
SGTSSASPIIAGAATLVQSIAKENLGQPYRPSELRAILSNENTGTKSKDPYADQIGVLPD
LKSILVNLGYGQRKPNGGNELQVTENEPNNERIQANKVNFHTPMKGTLHNSDRVDVFTFQ
MDSPENITISLLNEQNIGMTWVLHHESDLNNYVAYGENEGNVVKGTYHAKPGKYYLYVYK
YENKDGSYVLNIK
Download sequence
Identical sequences Q6HF54
WP_000689183.1.25316 WP_000689183.1.43104 WP_000689183.1.60841 YP_037822.1.62562 gi|49479179|ref|YP_037822.1| 281309.BT9727_3502 NYSGXRC-11297e

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]