SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281310.NTHI1921 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281310.NTHI1921
Domain Number 1 Region: 3-205
Classification Level Classification E-value
Superfamily CAC2185-like 1.29e-87
Family CAC2185-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281310.NTHI1921
Sequence length 206
Comment (Haemophilus influenzae 86 028NP)
Sequence
MNPFQKIKSAVNKCQRFFINRSLQRKLTNQGMTVISANCVGAFILHDLHQPFNSPFVNLC
LSPQDFLRYLQNMDFYRTQPLTFVQTEKSYPVGKLADLEIHFMHYHSEQEANEKWQLRTS
RMKLDNLFIMMTDRDGVTEKDIQLFDQLPFKNKVIFTHKPYPAFKSAYYIKGFEKQNQVG
DIFEFSGWNGKKYYDQFDYLKWFNQA
Download sequence
Identical sequences Q4QJX1
gi|68250224|ref|YP_249336.1| WP_011272706.1.12387 WP_011272706.1.20073 WP_011272706.1.28397 WP_011272706.1.32982 281310.NTHI1921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]