SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA00164 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA00164
Domain Number 1 Region: 912-1345
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.23e-139
Family Reverse transcriptase 0.0000108
Further Details:      
 
Domain Number 2 Region: 1517-1668
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.01e-38
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Domain Number 3 Region: 359-459
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 0.00000000225
Family Glycoprotein B-like 0.0087
Further Details:      
 
Domain Number 4 Region: 704-799
Classification Level Classification E-value
Superfamily Acid proteases 0.000000006
Family Retroviral protease (retropepsin) 0.042
Further Details:      
 
Weak hits

Sequence:  281687.CJA00164
Domain Number - Region: 605-699
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0706
Family ABC transporter transmembrane region 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA00164
Sequence length 1814
Comment (Caenorhabditis japonica)
Sequence
MELRAHKCFKTELIAKTFSFLSIYHSTVADVGRRESISVDECRKAVAEKKYVDQKLEEIS
PGVYRSNSTEHHAKNQTGWMGTKEYSFFELTVQTGNVATMDGKEIISNLGPMKECSFDAG
SCKKDEFTIVWEAQHTNTLCPYEYAYTSSAITNNEFLAIEETGVFSSIDRDIRKVQQVLH
ICSMSQAMLMDDGLLVEFPEIQNRKFNLDYVKRDNHFGRGSAEPPIFWKDLEERRPNVKA
IPEVKSPITDRVPLREIKAFNVSNDLIRYRFMFYPHDRRQGGLLAVLKSIRIAQYNWREK
KKLRKITTRPLTTSEETMLMLLNQDDAFMFDPLLEMEFGRISRFNQQLLHQNQYQHLKKI
TSTTAPRQNNESQPNQKKKSNEEIFNSVCKEQFAKTSLFETLLSIDPTAAVRSLLKRKDV
SAKMIGESLLVSKCREVKPSTVHWNRKVNNTCYDLVPVTIDEETWFQLPGSEDLVGEAVI
IPCEDRPDGIHMEHHRWLGADNREAHPQQFLRPNKMTQAQFLLEPPKTFYTTMNQETGAS
TGVDKENEARSSRYQRDLQRTLLKEGILNDGLEIIKETTEKASKSAKDIYNFTIGNIQKG
LRHVFFSTMHLLLWISLPTLVIFTLGCVIYGYLKYRAFRATCRLSARATQSTAEALLGLA
HHININNVQMENRQQRPNIRRPIRQEYPEVRVNAVRSSLVRAAKLPHIEVELQGRKINAL
FDTGAAVSYLPISSVPTDIETGHQPTAKAANGSSLQFLGTCKAILRIGEIFVPHTFLVSS
DLECPAPLLIGSDIIEKINKNGHDVNFNLFRRQLTIGCQSNSTCLREWSHNGSNTQPNSS
SINREKPIAIASVVGEIRTMEEAPEANWPDRLPNLPQDVPADFRPSQLVDLSDCNFTEEE
KESLREIIDRHPAAFVSLDGILGEYNGSIRHRIDLEEGCEVPTAKIYRIPLEKREEIQKQ
IALMLEQRIIRPSNSPFLAPIVLVRKADKKSWRFTVDFRSLNSVTKPVQSIIPNIQEILD
LCAGQEFYSSLDFQSGFHQILLEPEHSPRTAFACFLGAFEYIRMPMGLKGSPGTFQRIMN
DMIKEVQARVFVYIDDLIITSKTSEEHIRDIDEVLSKIESIGMKLRADKSKFGVKEIVFL
GFIVSKDGLKPDPAKTRAVMEYPTPKTVKEVRAFVGMASFYRRFIKNFSKIAAPIIDLTK
KDKMFDWNQDCEDAFQSLKNALTSKPILVAPRLGRPFVIEVDSSGRGVGAVLCQYQDLEE
KDLRVVAYASRVYNQHERNYPAIELEALGLTYAVKTFRPYIDGAHTTVITDHSPLKALLH
RKDLMGRLAKYQIVLQEFDIEIVYRPGKENVVCDTLSRHHPEEKKLEDKAESKLPIAHEK
SDTLPPQINVLMDSMFIDFDAIRTEQKEDEKIQEINSNLKMYHVQDDVIFKKIGGNWVIV
LPARSNYGSKLAKQIHESIFENAHLGREKTEQRVRSMAMWSGMSQEIKKIVTCCKTCQQI
KDPAQLRIKAPLGTFKTPTSPFERVHSDYIGPLPETRRGNRFIAMFVDAFTKFIIAEPVE
NQTADELCKIFVDRVVAKFGTPVLLVTDRGTQYTSNKFGDLLRSLRIKHSMSTAYHHEAN
GQVERANHSIEMLLRQVEDNENWDENLQTLVHAYNTAINATTSVSPYVVMHGQLPRSPLT
INLPKESAENPEQYAEKAIAKKKSLQKECKEQIEKKTKKRKEDHDENQVINNPIIQIGDR
VWIRKTANKTKTGKQFYGPLKVCKVEEPNVTVTLPGMLTRRTKEKTRTVHKNLCKLYRDN
DVEDSTEQKDITKE
Download sequence
Identical sequences CJA00164 281687.CJA00164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]