SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA08828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA08828
Domain Number 1 Region: 480-913
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.22e-133
Family Reverse transcriptase 0.0000494
Further Details:      
 
Domain Number 2 Region: 1104-1258
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.64e-38
Family Retroviral integrase, catalytic domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA08828
Sequence length 1614
Comment (Caenorhabditis japonica)
Sequence
MTPIWRMDTCLPRFAGPTVVNSTHLLALKNAAVVDFNNIATRMKESEERTAMEMRALAEQ
VDRRTTNIVSLERLVDQLRSRVIVLEEQAQGFALVGESVVSRSSTEHSGVRAPVVESGKD
LTVPDRSVEPSNPTDSVQNATSAAENSLAEEHEEARESQAPHIPRVCVLGFKSTTSIGTY
SGAFSESLSLFVRQFKDQMKAADAEASETAQVYAFLTFLVGNARDRAEEFLDGNANATVD
QLVADLKATFENELTGKLKEAQFAKCRQERGESIEMYFNRVRILAAQAFRCENKQMIEKK
ARDAFLNGLEDTIRYNVKDKDPKTCKQALDEAIRQEILREDRLASQQYAPTVALLDEMRS
FKNDWFNAQSKPRMQNNRDGSRRVKFRHIARDCMKRKAGLPKVVQTNDEAVRNHQIQQRP
AHVKAAVTEDLQSQLEIAKQRVFDNVNAVNTASVTEDPKFKISLDKAVCSEDQKEVLLKL
FSEFHDVFSKNAYDLGSSKTDPVHIYTNTEVPVRGRPYRVPVKYQAELEKHINGLLLSER
ITESNTPWISPIVLVPKKNGSLRVCLDFRKLNEVTVPDNFPLPRIDSIVEKVGGSKFFSS
LDMANGYLQLRLDAESSYKCGFTTEEKVYAYTHLPFGLKSAASYFQRALKTVLAGLEKDV
MLYIDDVLIFSKTFVEHVATLRKVLTRFREFNLKASPAKCEFVKKSIVFLGHEIGEDSYS
PNQANLDAIQQMPVPKDLKAVLRFVGMAGFFRKFIKNFSEIAEPLTKLNKKEQPFEWRVE
QQQAFDKLKELLTSKPILIYPDYEREFHIFTDASAVAQGAMLAQTTEDLDRFHVVAYASR
TLSEIETRRPAIQIELGAIIFALRHFKPYVCLSKIILHTDHRPLVYLLAKRKVNERLARW
LIELQQYDISIVHIDGKKNTVADCLSRAKDEVAPLPDEELEDVIEFPVCMAIDRANDRVS
KHFTPVGTRKPINIASEQNEDEDIRIITTFLTSPAASIEGISEEWTPFLERVSLSDKGIL
TVKFGGENTKVVIPKKLRKLVWESFHSSLLGGGHFNWRKSLHKAQKKYFWPGMRSEFLKW
TLECIKCQQKQNPHPSKRELQQVVITSHVFETVGVDLTGPLRTSTKGNKYYINMICWFSK
FVVSVPLPDATCESIARAILEELVLKFGTPNQIVSDNATSFTSAAFKQFCELLDISHHRA
IPYHSKGNGATERTFRTFHSMIAKHVNKSHTDWDTLLPYVTFNYNNTVHSTTGETPFFLI
FGRDPTLTIDRILDPSPKSVKTDLRLFKESLTTTLRDAWNEAAIRSREAQAVYQKKANEG
AQGSIIKAGDRVMYKDYSNHKGLSRKLVLPWAGDFRVVEVNPPTATIYDRRDSRKPERIV
HLDQIKKISSSEEDIDTPATEVDAVANDGENPEVEDRREEVIRNPEPTVQTTSKTLSNQT
ETSSDIAPVRRNPQRQRKLPTKESLHNDAPGMRGMKPQIRSPRKPKQFIKKKSQRRSTRL
NHKGWRQKVNPPTATIYDRRDSRKPERIVHLDQIKKISSSEEDIDTPVTEVDAVANDGEN
PEVEDQQEEVIRNPEPTVQTTSKTLSNQTKTSRDIAPVRRNPQRQRKLPAKFKT
Download sequence
Identical sequences 281687.CJA08828 CJA08828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]