SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA11645 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA11645
Domain Number 1 Region: 153-587
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.07e-132
Family Reverse transcriptase 0.0000306
Further Details:      
 
Domain Number 2 Region: 783-934
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.4e-36
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA11645
Sequence length 1156
Comment (Caenorhabditis japonica)
Sequence
MGNQQERDSRPGNYRLYLGENTTFPAESEQRVKGILNKKLINHDMVVHQQSDLFDRLGLS
ITPTVFRSQNALLLVTNPTRTDITVPARATIANVGRIHTAPDGSLHCSDTASDEAFPNIA
TTDSRLQPLDPDFKIDFNSIQCKEEERRQLKQLCEDYADVLSRNPYDLGSSKTDPVHIYT
TSEVPVKSRPYRVPVKYQAELEQHINALIRSERITESNTPWTSPIVLVKKKSGALRVCLD
FRRLNDITIPDNFPLPRIDAILEKVGGARYFSSLDMANGYLQLRLDAESSYKCGFITETK
VFAYTHLPFGLKSAASYFQRALKTVLANMDRDVLVYIDDILIYSQDFGQHIATLRNVFDR
FRQFNLKVSPKKCEFLKKAITFLGHTITESNYTPNEANVKSIAEMSTPKNLAEIRRFVGM
VGFFRKFLPNLATVAEPLTRLNRKNEKFRWETPQQEAFDTLREALLDKPILAFPDYENPF
HLFCDASAVGLGAALMQAETEEEKHFKAIAYTSRTLADSETRWPAIQVELLSIIFALRHF
RPYICLSKIILHSDHRPLSYLLSKHKVNDNLARWLIELQQYDIKIVHIDGKKNTVADYLS
RMQGESQPKEAELEDIVSFPICMANTTYEHVPPTVLKISGMNSIDINEEQRKDPVLVSVR
ALIEKRPTPCIDLPSEWKHYLKFVKISKRGTLVINFPGTPGLAEDKTIVPGALQELVITG
HHASLLGGGHFHWRPTMHKTQKKFFWPGMRTSIIQHCLRCQQCQLRRSKPPAQREQQLVV
PTNYVFQRVGIDLTGPLPVTAQGNRYYMNAICWFTRYVISIPLPDTRADTCARALLNHVV
LKYGAMSELISDGASGFTSTAFEHFCALLEIQHHTAIPHHSRGNGATERTFRTFHNSMAK
YVNNKHNDWEDHLQAVAFAYNTAQHSTTGESPFYLMYGRDPVFPIEKIIHPEPGNDATQD
PHEWKHHLTTTIQQAWRDAADHTEIAQGRYNNTANLGARPIDVKSGDLVVMRNFKSKVGL
SRKLVMPWEGLYRITSLERPFAYIVECRRPTKPPRKVHLDQIKKFLETSTSTRPSHQQVD
LSPAQLPPIARSATPMRTSGNIVASPSQNGPYTRAMPSSASRQPLPPPLVTGTAVNHDDT
PYVLRKTRRKPVRYRD
Download sequence
Identical sequences CJA11645 281687.CJA11645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]