SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA12482 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA12482
Domain Number 1 Region: 5-402
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.12e-26
Family Reverse transcriptase 0.023
Further Details:      
 
Weak hits

Sequence:  281687.CJA12482
Domain Number - Region: 458-530
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000759
Family Retroviral integrase, catalytic domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA12482
Sequence length 569
Comment (Caenorhabditis japonica)
Sequence
TGRAFYFPHQTVWKDSNTTKIRMVFDGSSHVTGELSLNQCVHAGPSILKEILGILLRART
SKFYMTSDIEKAFHQIRMQEDDRDCTRFLWFRNIKKGLVPGNIVTYRFKRIPFGLTCSPF
LLAAAILAYMDKYPASINEHINRNLYVDNILFTTNTEEELKQMYTDSKKATGTWGMRLRE
YQTNSEKVTEFIRAEDRAPDKPNKILGHIFNSKKDTVAISIPTPPRRGTDQKRSPLISSK
NLRPNRSSSTVRLKSFLQSLWSTQIKWRQNIPKVTTQIWESIKKDFHHTEYTMPRQLTTR
YDYSKTQLILFSDASKNNYGITAYIRFEFPSEPASCALLLAKSRVKPLKEGERMTIPRLE
LTSLETSTNCAVFLTQQLHNLIPFESVELFCDSIIALGWTTTHKTLKCVVKHRVDKIKQN
CKIIEEQEHQTQPASCPNRSQPSRFHNKTQKHHGPNIGLDYFGPLTYLGASGPQKCWILI
CTCLVTRNIHLELVSLSNNGTLGFMLAMRRFFSRRGTPQTVILDIAKTFKLGEKIFNGDI
RRLAEEDNAIDTFLDNHPMDWKFITPLSP
Download sequence
Identical sequences 281687.CJA12482 CJA12482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]