SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA21082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA21082
Domain Number 1 Region: 56-149
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 5.58e-17
Family ParB-like nuclease domain 0.0067
Further Details:      
 
Domain Number 2 Region: 142-203
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0000366
Family KorB DNA-binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA21082
Sequence length 331
Comment (Caenorhabditis japonica)
Sequence
MSRKNPFANLDLSSISSDKPAAKAGYGMTGAAKTVVRSIEEMAENTKRLMDGETIIEIEP
QLLDVSFAADRLSEDDDEFEALREAIKEQGQATPILVRPNPNNSERYMVVFGHRRARVAM
DLGIRVKAVVKKLDDISSAIAQGQENSARSNLSFIERAYFAQNLLSSGMGKDIVKSAIGI
DDALLSKMLSVVETVPSTMIMAMGASKKIGRDKWLSLRQIILNPAHLDVALSRIASVGFM
ALPEEERFDALHEYLKKYSVRSAAKAPAKVTTEKSWASEDKAVRFLMKQKPKNVAIELSS
AEARPFSDWLSSNMDRFYTEYKQSKPQSSGD
Download sequence
Identical sequences CJA21082 281687.CJA21082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]