SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA22258 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA22258
Domain Number 1 Region: 5-427
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.22e-123
Family Reverse transcriptase 0.0000519
Further Details:      
 
Domain Number 2 Region: 607-764
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.18e-40
Family Retroviral integrase, catalytic domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA22258
Sequence length 898
Comment (Caenorhabditis japonica)
Sequence
PGLGKCTKTKASIRLKPGAQPVFRKARPVPYATLPTITEELDRFVQEGIATPIDHAQWAA
PVVPIRKKNGSLRMCADFSTGLNDAIESHQHPLPTADDIFATLNGGKHFSQIDLAEAYFQ
IELDEDSKNLLCINTHRGLFQFNRLPFGVKPATAIFQQVMDSMISGIEGAAAYLDDIIIS
GGTVEEHNSRVKAVMQRIADYGFRIRIEKCKFLMKQIVFLGFVIDEHGRRPDPEKVADIQ
KMPAPTNVSQLRSFLGLIQFYGAFVKELFELRPPLNELTKKDQEFIWSPKCQKAFERIKE
ILQSDLLLTQFDPKLPIIVAADASQYGIGSVLTHRFPDGSEKAIYHNSQALTAAQRNYSQ
IEKEALGLVTAVTKYHRFIHGRHFTLRTDHKPLLSIFGDKKGVPVYSANRLQRWATILLN
YDFSIEYVNTHDFGQADALSRLIAEQSQSKEVEDQVIGQVECEVIANLVSTCNSLPVTVD
MISSASTKDTIIAEAINNVKHNSWPNKMDHGSILWNFFNRREQLSIVKDCLMLGDRVVIP
TALRHRVLKMLHRAHPGMVRMKQLARSFVYWPSLDKDIESTVRSCDDCAAAAKDPIKNTL
CSWPTPTAPWTRVHADYAGPIEGTYYLVIVDSYSKWPEVIATKSITSTSTISIFRKVFAQ
FGNPKTLVTDNGTQFTSTQFIDFCKEHGIQHIRSPPFHPQSNGQAERFVDTMKRALRKLQ
GEGNADTAIQVFLQNYRSTPCEASPHYLSPAENFIGRKIRTTLDLLLERMFQEHDKVYVK
DFRNPQNATWISGVVQKRIGRTLYKVLVNGSVWKRHTNQLRRRDIAPFAGSTDIWYLDVV
TPSRADNSNQLPSTTQPTPASPTSPRLIAPTQPTIRTSTRHRNQVKKLDIDPRTKSYK
Download sequence
Identical sequences CJA22258 281687.CJA22258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]