SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA24219 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA24219
Domain Number 1 Region: 95-222
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.23e-18
Family GntR ligand-binding domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 18-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.15e-16
Family GntR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA24219
Sequence length 227
Comment (Caenorhabditis japonica)
Sequence
MEHASVHDKTAKNSATLIDSWGSESLAEQAYRVLERSIVTLELEPGAIVNERSLIELTGM
GRTPIREAIQRLAWEGLVEVRPRSGIAIAQIDPTDFTKVLDAREGVERVLARDAARFGSA
RDYERLKAAADAMRQAIPSEDVSLFLDADKAFDIVLGTAASNPYAARLAAPLQTHSRRFW
FRLRPSTGITGSANAHATLIEAIVSREPERASDTASELMAYLRTLAP
Download sequence
Identical sequences 281687.CJA24219 WP_024895793.1.22424 CJA24219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]